Protein Info for ABID97_RS03800 in Variovorax sp. OAS795

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 199 to 215 (17 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 349 to 367 (19 residues), see Phobius details amino acids 373 to 390 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 184 to 331 (148 residues), 62.5 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0257)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>ABID97_RS03800 O-antigen ligase family protein (Variovorax sp. OAS795)
MQRSHIVRPAAMFWGLVVFMPVGVTYLSALLLLATLGLAGRYRERFARLRANPLWWPMVA
YLGWTFIVLAIGPHYPETGSNLFHGLRIGLTILMAMALTREEAIWALRGFLLIAALNVLL
ILAYHAFGFPIWAPLRAVVMEVGNKSISNALLFSVVASTAAVWGIAQIAAHRPLRALPAF
VLVLGLGLVVALPLTSRTSVLALMLVIPVVCIHQWRSHLKMLVSALVLGAVVLAAALYQL
PQLQHKVETGVEEIEKAQAGEIFKGSWVIRYYMYRDTGLMIADRPLTGWGIGGWTDQWHK
RGPALFAESNMPHNDFLWVGAQGGLPALLSLLAIMAGAVWQAWKRPDIAGRYALAATLIA
LIASSVNSAVRDAQIGLALLWIAMVYLRLAQEPRSAQPWNDLWPGSRIAAVPEAPASS