Protein Info for ABID97_RS03685 in Variovorax sp. OAS795

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00492: alanine racemase" amino acids 4 to 359 (356 residues), 343.5 bits, see alignment E=6.8e-107 PF01168: Ala_racemase_N" amino acids 9 to 218 (210 residues), 223.3 bits, see alignment E=3.3e-70 PF00842: Ala_racemase_C" amino acids 234 to 359 (126 residues), 138.4 bits, see alignment E=1e-44

Best Hits

Swiss-Prot: 95% identical to ALR_VARPS: Alanine racemase (alr) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 95% identity to vap:Vapar_0229)

MetaCyc: 54% identical to alanine racemase 2 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABID97_RS03685 alanine racemase (Variovorax sp. OAS795)
MPRPILATVHTAALRHNLDRARRAAVDARVWAVVKANAYGHGIERVFEGLRGADGFALLD
LAEAERVRALGWRGPVLLLEGVFDARDLELCSRLDLWHTVHCDEQIDMLAAHKTLKPQRV
FLKMNSGMNRLGFAPERFGSAWTRLNALPQVDEISLMTHFSDADGPRGIAHQMAVFERVT
HDLPGERSVANSAATLRHAAQARGDWVRPGILLYGSAPDFPQHDAAHWQLQPTMTLSTKL
IGVQTLQAGDTIGYGSNFTADGPLTIGVAAVGYADGYPRHCNTGTPVLVNGVRTRMVGRV
SMDMITVDLTPVPDAKFGAEVTLWGRSAATGAVLPIDEVAQAAGTVGYELMCAVAPRVPF
APADGE