Protein Info for ABID97_RS03680 in Variovorax sp. OAS795

Annotation: lysophospholipid transporter LplT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 356 (348 residues), 58.1 bits, see alignment E=3.7e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_0228)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>ABID97_RS03680 lysophospholipid transporter LplT (Variovorax sp. OAS795)
MKRGFYTIMSAQFFSSLADNAIFVVAVELMRSSGAAEWQRAALVPIFAVFYVVLAPLVGA
FADALPKGRVMFISNAIKVIGCLMMLFGSHPLLSYSIVGLGAAAYSPAKYGILTELLPAS
QLVKANGWIEGLTIASILLGIVLGGSLVGHAISSHLLAIDLPMINTGIDSPAEAAISVLI
FVYALAAWFNTRIPHTGVEMRPLRANPAHGLARNMFLLLPDFWHCNARLWRDKLGQISLA
TTTLFWGAGANLKYIVLAWAALALNYNTTQATALTGVVTIGMAVGAIVASMRMRLDMATR
VIPMGVGMGLLVISMNLITNVWIAVPFLILLGGLGGFLVVPMNALLQHRGHNLMGAGRSI
AVQNFNEQACILLLGGFYSACTGLGLSAFAAIGAFGGVVAGCMWLIQRWHHHNLRKYPEE
VEHLLAIARSDKHH