Protein Info for ABID97_RS03570 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 370 (351 residues), 84.4 bits, see alignment E=3.9e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ABID97_RS03570 MFS transporter (Variovorax sp. OAS795)
MNAPSPTLYDRRMVGWLSVGQLITWGSVFYAFALLMEPVERELGLSRAQSSLAFSLALLA
EGALAWPVGRWIDRGHERAVMAGGSLAVAAGLLLHSLVQGALGFYLAWTLLGAGLAATLY
NPAFSIVTRRFPHDFRRAIITLTFLGGLASTVFIPLVAWLIAELGWRHALWVLAGIHLFV
CVPLHARVLRHAPPPATPTAPTTPAPTAGKATGAAPGSHPASHYMRSAPFLFVGVFTVLL
MAVTAALPPHMVSLLRGAGLAESWAIALPAGIGLVQVLGRALLYFFEHHFDLHLANRLIP
CLIPIGLLALLAGAAHPGAAVLFVFFYGMGNGMLTIVKGTAIAQYVNREHVATLNGALGL
PSAIARALAPLMLGVLWQPDTGYTTGLWVLLGASVVAVLALVAAQRWRDAAGTAA