Protein Info for ABID97_RS03530 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 377 to 394 (18 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details amino acids 471 to 491 (21 residues), see Phobius details amino acids 520 to 539 (20 residues), see Phobius details amino acids 559 to 582 (24 residues), see Phobius details amino acids 594 to 615 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 11 to 289 (279 residues), 110.9 bits, see alignment E=3.3e-36 amino acids 349 to 604 (256 residues), 138.2 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein K01998, branched-chain amino acid transport system permease protein (inferred from 98% identity to vap:Vapar_0183)

Predicted SEED Role

"putative permease component of branched-chain amino acid transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (640 amino acids)

>ABID97_RS03530 ABC transporter permease (Variovorax sp. OAS795)
MSLSSLLLQFLTGLSSASSLFLVGAGLSLIFGVTRIVNFAHGSFFMVGIYLAYTLVDKLG
TLGFWPAVLIAALAVGVIGALIEMVLLRRIYKSPELFQLLATFALVLVIKDAVLYVWGPD
ELLGPRAPGLSGSVEILGRQFPTYDLFLIVVGPVVLGLLWLLLTRTRWGTLVRAATQDRE
MVSALGVNQAWLFTAVFALGATLAALGGALQLPREPATLAMDLNTIGAAFVVVVVGGMGS
IPGAYVAALLLSEIKAVCIWLGVVEIFGYSVSFSKLTLVVDFIVMAIVLVWRPWGLLGRP
QAPSRYVGMQEEPLRRASKGYLWLVAALGLALMAMPLFTADSPYTTVLMIDLLIAALFAA
SLHFIMGPAGMHSFGHAAYFGLGAYGAALLVRASGMPMELALIVAPLVAAIGAFVYGWFA
VRLSGVYLAMLTLAFAQITWAVVYQWDSFTGGSNGLTGVWPSEWLSDKRTYYWLTLVLVA
AGILMLRRVLFSPFGYALRAGRDSVLRADAIGIDVKRMQWTAFVIAGAAAGLAGSLYAFS
KGSISPESLSVDKSVDGLVMVLLGGIQTLAGPVVGAVTFSWLHDTVARNTDYWRATLGAI
ILLLVLLFPQGIAGFAKQLSERLLRGRRSQADVALKEKRT