Protein Info for ABID97_RS03430 in Variovorax sp. OAS795

Annotation: HutD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details PF05962: HutD" amino acids 12 to 174 (163 residues), 170.4 bits, see alignment E=2.4e-54

Best Hits

KEGG orthology group: K09975, hypothetical protein (inferred from 86% identity to vap:Vapar_0163)

Predicted SEED Role

"Conserved hypothetical protein (perhaps related to histidine degradation)" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>ABID97_RS03430 HutD family protein (Variovorax sp. OAS795)
MNSVRRFSCAALPAAPWKNGGGSTQEIVSWPPGAGLDGFGWRASIAAIAAAGPFSIFAGV
DRSIMLLEGDGVRLFTHDGRVEHRLDVAHRPFAFSGDDAIDCTLLGGASTDFNVMTRHGQ
WRADVRVLDHASAVETAAHGVLLALRGAWRLNGEPCAEGDGLYWTDTAKAWQAEPQSEGA
RLAAVRILPA