Protein Info for ABID97_RS03395 in Variovorax sp. OAS795

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 20 to 479 (460 residues), 511.8 bits, see alignment E=1.8e-157 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 20 to 629 (610 residues), 778.4 bits, see alignment E=4.5e-238 PF00270: DEAD" amino acids 35 to 198 (164 residues), 81.7 bits, see alignment E=1.3e-26 PF00271: Helicase_C" amino acids 237 to 345 (109 residues), 69.4 bits, see alignment E=7.9e-23 PF16124: RecQ_Zn_bind" amino acids 357 to 418 (62 residues), 69 bits, see alignment E=1.2e-22 PF09382: RQC" amino acids 420 to 534 (115 residues), 118.8 bits, see alignment E=2.9e-38 PF00570: HRDC" amino acids 563 to 627 (65 residues), 82.5 bits, see alignment E=4.1e-27

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 97% identity to vpe:Varpa_0178)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>ABID97_RS03395 DNA helicase RecQ (Variovorax sp. OAS795)
MSSLAPLPLDAPGSSSAPADILHEVFGYSQFRGPQQEIVDHVVGGGDALVLMPTGGGKSL
CYQIPAIARQRAGRGVSVVVSPLIALMHDQVGALHEAGVNAAFLNSTLDWEQTQDVERRM
LRGEITLLYAAPERVNTPRFLSQLDSLKERGKLSLFAIDEAHCVSQWGHDFRPEYRALTV
LHERYPGVPRIALTATADALTRADIVERLQLEEARQFVSSFDRPNIRYTIVEKKDATTQL
LRFIEREHEGDAGVVYCQSRKRVEDVAVMLKGAGINALPYHAGLDAAVRQKHQDRFLREE
GIVMVATIAFGMGIDKPDVRFVGHLDMPKNIEGYYQETGRAGRDGAPADAWMTYGLQDVV
NQRRMIDESPAGEEFKQVMRGKLDALLSLAEASDCRRVRLLGYFGEQSTPCGNCDNCLNP
PQVWDGTDAARKLLSTIYRVQQLSGISFGAGHIMDILRGKETEKVKQFGHERISTFGLGA
EFSEVQLRGVLRQLIATGALAVDAEAFNTLKLTEGSRAVLKGESNVTLRESISSPAERKP
RREKVAKGAPSPAAAKLDGTGQKRFEALKAWRAEVAREHNLPAYVIFHDATLAAIAERAP
ATLEDLQGISGIGTKKLEAYGTEVLRVCSAF