Protein Info for ABID97_RS03340 in Variovorax sp. OAS795

Annotation: nucleoside recognition domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 5 (5 residues), see Phobius details transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 53 (25 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 204 to 230 (27 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details PF07670: Gate" amino acids 51 to 159 (109 residues), 41.4 bits, see alignment E=8.8e-15 amino acids 276 to 379 (104 residues), 43.2 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_0141)

Predicted SEED Role

"Fused spore maturation proteins A and B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>ABID97_RS03340 nucleoside recognition domain-containing protein (Variovorax sp. OAS795)
MLNGLWLGFFGMAMLAALGRWLWGGDPAVFAAIVESLFAMARLAVEVMVLLFGTLTLWLG
FLRIAEAAGLVGWLARLLGPLFRRLMPGVPAGHPALGLITMNFAANALGLDNAATPIGLK
AMRELQRLNPDPVTATNAQILFLVLNASSLTLLPVTIFMYRAQQGASDPTMVFLPILLAT
SASTLVGLLSVAVAQRLRLWDPVVLAYLVPGALLLGGFMALLGTLSAAAIASLSSLMGNL
ALFGVIIVFLLAGAIRRIQVYECFIEGAKEGFDIAKSLLPYLVAMLCAVGVLRASGALDF
VLGGLRWLVDMGGWDSRFVDAMPTALVKPFSGSAARAMLIETMKTQGVDSFPALVAATIQ
GSTETTFYVLAVYFGAVGIQRARHAVACALTAELAGVVAAIAVCYWFFG