Protein Info for ABID97_RS03305 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 8 to 11 (4 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 144 (133 residues), 48.2 bits, see alignment E=6.5e-17 amino acids 157 to 293 (137 residues), 58.6 bits, see alignment E=3.9e-20

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_0138)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>ABID97_RS03305 DMT family transporter (Variovorax sp. OAS795)
MIQRKTHLDSLAIGLLIACCAFWGLQQILIKTTVAEVPPLWQASIRMAGAVALLWLWCVS
RGVPLFERDGTLPGGLLVGLLFAGEFACIYLGLQHTSASRLTVFLYTAPFWVSLLLPRWV
PAERLRGLQWLGLAIAFAAVLFAFSEGFAQTSSSQLIGDAMGLAGGMLWGLTTLALRTTR
LATASAEKSLFYQVGVTAAVCPVLSLVLGETWSFSYSAWAWTSIGLQTVVGAFASYLTWM
WLLRHYPATQMSSFSFLTPLFALVFGVVLLGEPLTLQLMLALAGVAIGIVMVNRRRARP