Protein Info for ABID97_RS03300 in Variovorax sp. OAS795
Annotation: glutaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to GLSA_STRAW: Glutaminase (glsA) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 96% identity to vap:Vapar_0137)Predicted SEED Role
"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)
MetaCyc Pathways
- L-glutamate and L-glutamine biosynthesis (7/7 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-citrulline biosynthesis (6/8 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (3/4 steps found)
- superpathway of L-citrulline metabolism (8/12 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- D-Glutamine and D-glutamate metabolism
- Glutamate metabolism
- Nitrogen metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (312 amino acids)
>ABID97_RS03300 glutaminase (Variovorax sp. OAS795) MKDTDFQPVLDDIVGTLRPLLGQAGTVASYIPALACIDPRQLGIALRTCDGTEAFAGDAE TPFSIQSVSKLFTLTLAMQRSGEALWERIGREPSGNPFNSLVQLENEHGKPRNPFINAGA IAVADRLVSQALQAGGSAKADILALMASLCGEPIAFDDEVARSEAATGFRNVALANFMKS FGKIDNDVAVVLDTYFHQCALRMSCRQLARAAAFLCRDGAHPIDGQAEVTGERQTRRINA LMLTCGTYDAAGDVAFSIGLPCKSGVGGGIVAVVPDRLTLCVWSPALDANGNSLLGMKAL ELFVARTGLSVF