Protein Info for ABID97_RS03125 in Variovorax sp. OAS795

Annotation: benzoyl-CoA 2,3-epoxidase subunit BoxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR03224: benzoyl-CoA oxygenase/reductase, BoxA protein" amino acids 9 to 428 (420 residues), 743.6 bits, see alignment E=2.9e-228 PF13237: Fer4_10" amino acids 14 to 60 (47 residues), 30 bits, see alignment 2.3e-10 PF00037: Fer4" amino acids 15 to 36 (22 residues), 29.1 bits, see alignment (E = 3.5e-10) PF13187: Fer4_9" amino acids 20 to 63 (44 residues), 29.2 bits, see alignment 4.2e-10 PF12838: Fer4_7" amino acids 20 to 62 (43 residues), 29.9 bits, see alignment 3.5e-10 PF00970: FAD_binding_6" amino acids 208 to 273 (66 residues), 21.2 bits, see alignment E=1.6e-07 PF00175: NAD_binding_1" amino acids 287 to 395 (109 residues), 47.5 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_0095)

Predicted SEED Role

"Benzoyl-CoA oxygenase component A" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>ABID97_RS03125 benzoyl-CoA 2,3-epoxidase subunit BoxA (Variovorax sp. OAS795)
MDMAVEAGIIKQHLIDPEICIRCNTCEATCPVNAITHDDNNYVVRADVCNGCMACISPCP
TGSIDNWRTMPLVRAYSIEEQLTWESLPAELSPEELEAAGVSAEAAGDAAADVPAQTQAQ
AAVDSVEPVFNSAQYGATVPPWSAAHAYTNLFPPKSPTTATVVGNFNCTEAGFDSETHHI
VLDFGVVPFPVLEGQSIGIVPPGVDAIGKRHHARQYSVASPRNGERPGYNNVSLTVKRVT
EDHQGQPVRGLCSNYVCDLKVGDTVQVVGPFGSSFLMPNHPRSHIVMICTGTGSAPMRAM
TEWRRRLRKSGKFEGGKLMLFFGARTQQELPYFGPLQSLPKDFIDINLAFSRTPGQPKRY
VQDLMRERAADLAALLKDGASHFYVCGLKSMEEGVVLALRDVAKEAGLDWDTVGAALKRE
GRLHLETY