Protein Info for ABID97_RS03080 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 253 (30 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 278 (267 residues), 138 bits, see alignment E=1.8e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to vap:Vapar_0086)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABID97_RS03080 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MDFGTFLVQCLNSVQYGLLLFLVASGLTLIFGIMGVINLAHGSFYMIGAYMAFALAPLFG
DQFLLMLVAGVVLAAVFGYLLEWAFFSYLYQRDHLQQVLMTYGLILVFEELRSILVGNDV
HGVKVPAWLDGSFALGNVMSYPWYRLFASAACIVLAAGLYWVVNRTRLGMMIRAGASNRD
MVRGLGIDVKRLYRIVFAAGVALAALAGMIAAPMSSVYPNMGASVLIICFVLVVIGGIGS
ITGALLASLLVGFVDTFGKVFFADLAGIGIYLLMAIVLIWKPEGLMGRRP