Protein Info for ABID97_RS03010 in Variovorax sp. OAS795

Annotation: solute carrier family 23 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details amino acids 381 to 398 (18 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 23 to 420 (398 residues), 363.8 bits, see alignment E=6.3e-113 PF00860: Xan_ur_permease" amino acids 28 to 398 (371 residues), 302.5 bits, see alignment E=2e-94

Best Hits

Swiss-Prot: 70% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_0068)

MetaCyc: 70% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>ABID97_RS03010 solute carrier family 23 protein (Variovorax sp. OAS795)
MSNLFSWREVAATEGRVVAPDERLPWLQTGAMGVQHVIAMFGATVLAPILMGFNPNIAIL
MSGIGTLIFFLVTGGKVPSYLGSSFAFIGVVIAASGYAGKGPNANIAVALGGIVACGVIY
ILIGALVQAIGTGWIERFMPPVVTGAVVAVIGLNLASVPIKNMAASNFDSWMQAVTFLCV
GLVAVFTRGMLQRLLILIGLILATVVYALLTNLLGMGKPVDLSGIANAAWFGLPTFTAPV
FTTNAMLLIAPVAIILVAENLGHLKAVTAMTGRNLDPYIGRAFIGDGIATVVSGAAGGTG
VTTYAENIGVMAATRIYSTAVFVVAALIALVLGFSPKFGALIQAIPLPVMGGVSIVVFGL
IAIAGAKIWVDNKVDFSQNKNLIVAAITLIIGTGDFTLKFGQFALGGIGTATFGAIILYA
LLGGTRNASAPAK