Protein Info for ABID97_RS02945 in Variovorax sp. OAS795

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01923: Cob_adeno_trans
  • amino acids 8 to 166 (159 residues), 183.2 bits, E=2.2e-58
• TIGR00636: ATP:cob(I)alamin adenosyltransferase
  • amino acids 10 to 178 (169 residues), 185.8 bits, E=2.7e-59

Best Hits

Swiss-Prot: 70% identical to ATR_CUPMC: Cobalamin adenosyltransferase (cobO) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 94% identity to vpe:Varpa_0059)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (21/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Protein Sequence (203 amino acids)

>ABID97_RS02945 cob(I)yrinic acid a,c-diamide adenosyltransferase (Variovorax sp. OAS795)
MGNRLSQIATRTGDDGTTGLGDNTRVPKDHLRVHAMGDVDELNSQIGVLLCEPMPEPVRE
LLVDVQHQLFNLGGELSMPGFTLLKSEALLQLDNALAEHNAALPRLAEFILPAGTRAASL
AHVCRTVARRAERAVVALGATAELNDALRQYLNRLSDLLFVLARVLNRMNGGDDVYWKSE
RMARAAAEAVDAGHPDDKKGSPS