Protein Info for ABID97_RS02890 in Variovorax sp. OAS795

Annotation: DUF1328 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 43 (38 residues), 49.3 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 82% identical to Y066_POLSJ: UPF0391 membrane protein Bpro_0066 (Bpro_0066) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_0048)

Predicted SEED Role

"protein of unknown function DUF1328"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (61 amino acids)

>ABID97_RS02890 DUF1328 family protein (Variovorax sp. OAS795)
MLKYAIIFALISLVAAVLGFGGIAAGAAGIAKLLFGLFLVLAVLFVVLAALGVGAVKKAI
D