Protein Info for ABID97_RS02870 in Variovorax sp. OAS795

Annotation: alkene reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00724: Oxidored_FMN
  • amino acids 3 to 345 (343 residues), 271 bits, E=8.5e-85

Best Hits

KEGG orthology group: K10680, N-ethylmaleimide reductase [EC: 1.-.-.-] (inferred from 95% identity to vap:Vapar_0039)

MetaCyc: 66% identical to nitroglycerin reductase (Agrobacterium tumefaciens)
1.7.1.-; 1.7.1.-

Predicted SEED Role

"Oxidoreductase, FMN-binding"

MetaCyc Pathways

• nitroglycerin degradation (2/5 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (367 amino acids)

>ABID97_RS02870 alkene reductase (Variovorax sp. OAS795)
MPSLFDPVQAGDLKLANRIVMAPLTRNRSPEAIPQDIAATYYAQRATAGLLITEATAVSH
QGQGYADVPGLYGTEQLDGWKRVTDAVHAKGGKIVVQLWHVGRVSHTELQPEGGKPVAPS
AITAKTKTVLIKDGVPTFVATSEPRALDVEELPGIVHTFAAAARNAVETAGFDGVELHGA
NGYLLDQFLKDGSNKRTDDYGGSIENRARLLLEATRAVVDAVGGGRTGIRLSPVTPANDV
HDSDPQPLFTYVVKQLAPLGLAYVHVIEGATGGPREIEDRPFDYEALKAAYRQAGGKGAW
MVNNGYDKPLADEAVKEGDDLVAFGKPFIANPDLVRRLRENAPLNEVDKATMYGGGTKGY
TDYPALG