Protein Info for ABID97_RS02855 in Variovorax sp. OAS795

Annotation: sensor histidine kinase N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 30 to 171 (142 residues), 78.7 bits, see alignment E=6.9e-26 PF00512: HisKA" amino acids 248 to 311 (64 residues), 46.3 bits, see alignment E=5.5e-16 PF02518: HATPase_c" amino acids 365 to 460 (96 residues), 61 bits, see alignment E=2.2e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_0037)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABID97_RS02855 sensor histidine kinase N-terminal domain-containing protein (Variovorax sp. OAS795)
MSLSTTDAPRPDEAAPSLTRRVLRNVLVPLALTWMLGAVIALVIANYFSEQAFDRGMLDD
AYALAANVQAGERGVELLLTPREVATVLFDQVDKVYFAVQRLDGTLISGQAGLHAPLPAE
GAHFRFSDIDFDGKVLRAVVLQPVAEPGLPVPYRVVIAQTTLSRTALVRRLLGYALAPQV
LLLMLLAVWLWYGIRSDLRPLGELQQALDRRDVYDLSPVAVVRTSREVQRLGNAVNALFD
RLNHSVRAQREFVGNVAHELRTPLAGIRALAEYGLAQHDSAVWREQLVRVGERQARASHL
IDQLLALALADEARTGLARQPVRLDVLAEQTVLRHLARADARGVDLGARGLDERTTVLAN
DALVEGILDNLIDNALRYGGRTITVELAGRTLSVIDDGPGIPIDAQRDLMQRWAQGPAGQ
KLGQGSGLGLSIVARYAELLGAELRLDAAEPSGLRVSVEFGDLA