Protein Info for ABID97_RS02815 in Variovorax sp. OAS795

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 8 to 132 (125 residues), 166.6 bits, see alignment E=1.3e-53 PF13411: MerR_1" amino acids 9 to 72 (64 residues), 62.8 bits, see alignment E=4e-21 PF00376: MerR" amino acids 9 to 45 (37 residues), 55.6 bits, see alignment E=5.4e-19 PF09278: MerR-DNA-bind" amino acids 51 to 114 (64 residues), 76.8 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 56% identical to HMRR2_RHIME: Heavy metal-dependent transcription regulator 2 (hmrR2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0029)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>ABID97_RS02815 Cu(I)-responsive transcriptional regulator (Variovorax sp. OAS795)
MSSFGTVAIGEAARLSGVSARMVRHYEGLGLLPAVARTESGYRQYGDADIHTLRFIKRSR
DLGFSMEEIAELVGLWHNRRRASASVKRIAEKHLGELEQRIADMQSMRNTLAHLVHCCQG
DARPDCPILDDLAEAKAA