Protein Info for ABID97_RS02780 in Variovorax sp. OAS795

Annotation: cell envelope integrity protein CreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 330 to 348 (19 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details PF06123: CreD" amino acids 12 to 459 (448 residues), 431.6 bits, see alignment E=1.6e-133

Best Hits

KEGG orthology group: K06143, inner membrane protein (inferred from 82% identity to vap:Vapar_0023)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>ABID97_RS02780 cell envelope integrity protein CreD (Variovorax sp. OAS795)
MSQFMKAVQGSMLVKVAGLVMLTLVLCGPLAEINSLNQERGHSQRAAAVELAATYAGAQT
VVGPLLLVPYVERWMEPLRDAQGKVIGQQARSKDMAHAVFPDKLHIEGSMATQERYRGIF
KIPFYTLDATLGGSFGAFDPKSVAHSEADSHIEFKAPLVVFAVSDLRGLDGSPAIAMNGE
ALRFRQRVPGLADEAWLADGIHAPLAGAALSAWEAKAPLPFELKLGLVGQETLSMVPIAE
ETTAHLRSAWAHPSFGGRFLATEREVTPQGFDAKWRVSALVTSAREQVREGLSGNAKQAA
QHRLGALQTFDVSLAQPINVYSMSTRAGKYGALFIGLVIMAAFMFELFRRQRMHPVQYGL
VGLSIALFFLLLLALSEKLAFWLAYAGAASASVLLLGIYFSAVLHSWQRGAGFGAYVAVL
YGSLYGLLASESNALLLGALLTFGMLAVLMLATRKVDWYALSQRAEPAAPVA