Protein Info for ABID97_RS02775 in Variovorax sp. OAS795

Annotation: VIT and VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 663 to 679 (17 residues), see Phobius details PF13757: VIT_2" amino acids 60 to 127 (68 residues), 45.4 bits, see alignment E=1.5e-15 PF08487: VIT" amino acids 64 to 174 (111 residues), 113.7 bits, see alignment E=1.3e-36 PF13768: VWA_3" amino acids 326 to 472 (147 residues), 69.1 bits, see alignment E=1.1e-22 PF13519: VWA_2" amino acids 326 to 428 (103 residues), 45.4 bits, see alignment E=2.9e-15 PF00092: VWA" amino acids 326 to 482 (157 residues), 58.4 bits, see alignment E=2.8e-19 TIGR02595: PEP-CTERM protein-sorting domain" amino acids 658 to 681 (24 residues), 16 bits, see alignment (E = 8.4e-07)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 90% identity to vap:Vapar_0022)

Predicted SEED Role

"FIG01161751: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>ABID97_RS02775 VIT and VWA domain-containing protein (Variovorax sp. OAS795)
MDAHTTPRTGRWLWLATLSLAAAGFAALALNPVHAQEAPGPRLKTESPYFFVKSGDPSVD
PLPLKGTEVTVKISGVIADVTVTQTYRNEGQRAIEAKYVFPGSTRAAVNGLNVRLADRMI
TAQIREKLQAQIEYDTAKKEGKTAALLEQHLPNVFQMNVANILPGDDVKVELRYTELLVP
QSGNYAFVFPTVVGPRYNSPQSENAQAKWVAQPTLREGAAPAASFRLKASIDTPMGLKEV
RSATHAIDVTKNDEDRHADVVLMADGRPADNRDFVLDYRLAGEKIESGLMLYKGQNTNGD
AENFFLAMIEPPKAVPASAISPRDYIFVVDISGSMHGFPLDTAKTVLERLIGGLRPSDTF
NVLLFSGSNKMLSPQSVPATRANIERALSTIQNYAGSGSTELIPALRRVYAEPKEENVSR
TVVLVTDGYVTVEREAFELVRKNLSKANVFAFGIGSSVNRSLMEGIARAGMGEPFIITDP
RQAPEQAARFRRMVESPVLTSVKLSFGGLDVYDVEPQALPDVLGERPVIVFGKWRPDADG
KARGRVIVEGRGADGPYRQELRIDPRMRQDTAALRTLWARHRIQSLSDQEALDGSGDHKA
RITELGLKYSLLTQYTSFIAVDQVVRNLAPQNNAEVAQPLPLPQGVSELALGAEVPSTPE
PETLGAIAVVLSMLAMLRRRARRHDPRRFTA