Protein Info for ABID97_RS02725 in Variovorax sp. OAS795

Annotation: cardiolipin synthase ClsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 28 to 138 (111 residues), 50 bits, E=2.8e-17
  • amino acids 218 to 344 (127 residues), 109.2 bits, E=1.5e-35
• PF00614: PLDc
  • amino acids 111 to 133 (23 residues), 30.1 bits, see alignment (E = 3.5e-11)

Best Hits

Swiss-Prot: 56% identical to CLSB_ECOLI: Cardiolipin synthase B (clsB) from Escherichia coli (strain K12)

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 86% identity to vap:Vapar_0012)

MetaCyc: 56% identical to cardiolipin synthase B (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]; RXN0-7272 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• cardiolipin biosynthesis I (3/3 steps found)
• cardiolipin biosynthesis II (3/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• cardiolipin biosynthesis III (2/3 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Protein Sequence (426 amino acids)

>ABID97_RS02725 cardiolipin synthase ClsB (Variovorax sp. OAS795)
MDSGGRWVGGNRIALLENGEEFFPRVFDAIREAKREVIIETFILFEDKVGLALHAAMRAA
AQRGVKIDVLVDGFGSPDLSREYIEGLTSVGVRMRVFDPGKRILGQRLNVFRRMHRKIVV
VDGELAFVGGINYSADHLMDFGPKAKQDYAVELRGPIVAQIHQFVLRAIALGDKGPRWFR
RRLKRAPPVEREAVGETEAIFVSRDNRRHTNDIERHYLAAIRAARQRIVIANAYFFPGYR
LIKELRRAARRGVDVRLILQGEPDMPIVKTAASMLYHHLLHAGVRIFEYCDRPLHAKIAL
MDDQWSTVGSSNLDPLSLSLNLEANVIARDRAFNQLMWERMDRLMRESCKQIGEADLESG
WSGWRLVRSFFIFHFLRWYPSWLGWLPRQVPRLTPAEVVALAERREQREKNSQKNGKDAV
TPTEVA