Protein Info for ABID97_RS02660 in Variovorax sp. OAS795

Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 25 to 26 (2 residues), see Phobius details transmembrane" amino acids 22 to 24 (3 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details amino acids 441 to 463 (23 residues), see Phobius details amino acids 486 to 503 (18 residues), see Phobius details amino acids 515 to 539 (25 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 4 to 374 (371 residues), 331.7 bits, see alignment E=7.9e-103 PF14849: YidC_periplas" amino acids 83 to 365 (283 residues), 259.8 bits, see alignment E=4.7e-81 PF02096: 60KD_IMP" amino acids 369 to 555 (187 residues), 254.9 bits, see alignment E=5.1e-80 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 375 to 554 (180 residues), 221.6 bits, see alignment E=9.6e-70

Best Hits

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 94% identity to vap:Vapar_5299)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>ABID97_RS02660 membrane protein insertase YidC (Variovorax sp. OAS795)
MNDIRRTILWVIFGFSLVLLWDQWQVFNGNKPTFLPSSKPAAVASAPAGGTPATANGVPT
ASAAGGSPAAVPAQAAPAAPRERVNVTTDLFKAVIDSEGATVNYLELLKYEEADRTKHVV
LFENDSAATRYVAQTGLLSQTGEAFPNHLTPMTPKAGPREMAEGQNTLEVSFESAPSGGL
KYVKTYLFKRGEYTIGVRHEVVNVSDQPRDAQLYMQLLRHGTVAAGTMFGTNTFTGPAAY
TNEKKFHKLDFKDISKGKIEPPPPANDGWIAMVQHYFVSAWLLKGDPASEQLRREFRVKD
LGDNLYTVAMVATLPKIAPGQTQVVNSALFAGPEEEKKLEAIAPGLDLVKDYGIFAIISK
PLYWLLNQLHGILGNWGWAIVALVVLLKAAFYWLNAKAYASMAKMKAINPKIMEMRERLK
DKPQEMQQEMMRIYKSEKVNPMGGCFPIVIQIPVFIALYWVLLSSVEMRHAPWIGWITDL
SAPDPWYILPVVMTLTSLFQTWLNPTPPDPMQAKLMWIMPLAFSVMFIFFPAGLVLYWIT
NNVLSIAQQWFINKRLGVLGK