Protein Info for ABID97_RS02605 in Variovorax sp. OAS795

Annotation: TMEM165/GDT1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01169: UPF0016
  • amino acids 6 to 80 (75 residues), 78.2 bits, E=2.4e-26
  • amino acids 105 to 180 (76 residues), 82.5 bits, E=1.1e-27

Best Hits

Swiss-Prot: 49% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_5289)

Predicted SEED Role

"Probable transmembrane protein"

Protein Sequence (187 amino acids)

>ABID97_RS02605 TMEM165/GDT1 family protein (Variovorax sp. OAS795)
MEAFLVATGVVALAEMGDKTQLLALLLAARFRRPWPIVLGIFAATIVNHALAGAVGNYIT
HWLGPEVLRWILGGSFVAMAAWMLIPDKLDEDDAPAASHYGVFGTTLIAFFLAEMGDKTQ
IATVMLAARFTEAYLWVVAGTTLGMMLANAPVVWFGDRIVKRVPIKLVHGISAAIFLVLG
IVMIVGW