Protein Info for ABID97_RS02560 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 230 to 230 (1 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details PF07690: MFS_1" amino acids 5 to 244 (240 residues), 35 bits, see alignment E=3.9e-13 amino acids 213 to 386 (174 residues), 44.8 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_5280)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>ABID97_RS02560 MFS transporter (Variovorax sp. OAS795)
MNRNLWLLAICQGLFLTNNVTFIAINGLVGLGIAPQGWMATLPVMGYVVGGALTTGLVAR
TQQRFGRRGSFQIGLAVGFGSALLCAFAAISKNFWLLCFATVVAGYYNANAGLYRFAAAE
LAAPAWREKAVSLVMAGGLIGAVAGPNLAAATREVFAVPFAGAYIALAAVALLSMGVMRF
IEFPATLTRQQALGGRPLSEIMRQPVFIVAAAAGALGFGVMNLLMAATPIAMQICSLPFS
DAALVLEWHVIGMFAPGFFTGHLIRRFGALPVMGVGLALNFCCIAVALSGVELQHFLVAL
FLLGVGWNFLFTGSTTLSLTAYTAEERDRAQGALNFCVFATVALTSFASGVLVTTQGWQL
LNYGSLVPVVLLGAALLWLAQTRRREAAANA