Protein Info for ABID97_RS02200 in Variovorax sp. OAS795

Annotation: nucleoside-diphosphate sugar epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details PF01370: Epimerase" amino acids 282 to 515 (234 residues), 58.4 bits, see alignment E=2.3e-19 PF04321: RmlD_sub_bind" amino acids 282 to 410 (129 residues), 34.5 bits, see alignment E=3.8e-12 PF02719: Polysacc_synt_2" amino acids 282 to 588 (307 residues), 375.3 bits, see alignment E=5.8e-116 PF16363: GDP_Man_Dehyd" amino acids 283 to 410 (128 residues), 38 bits, see alignment E=4.1e-13 PF01073: 3Beta_HSD" amino acids 283 to 415 (133 residues), 24.4 bits, see alignment E=4.4e-09

Best Hits

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (635 amino acids)

>ABID97_RS02200 nucleoside-diphosphate sugar epimerase/dehydratase (Variovorax sp. OAS795)
MQKTILNWSRAKKQSLVIGLDVGLALASMWLAFTLRLDSFHRPVGAEWLAYAISPILVIP
VFIKFGLYRAIFRYTGITTILDTGKAVAIYGAVLSPFIWALYHWEGVPRSLIILQPVIFL
LLVSSSRTLGWRWLAGPGNRAVRRLLIYGAGTAGAQTAAALAGTEHYVLLGFIDDDPSKN
GRSINGAPVFSSAGIQETISLFSVTDVLLALPSASRQRRNQIIKRLQPLPVRIRSLPSLA
DLASGRITVRDFQDLDIEDLLGREPVVSDPALLARSLAEQVVMVTGAGGSIGSELCRQII
LQKPRQMILLDHSEFLLYGIHQELLQLLAACNLNVELIPRLANVCNYERIYALCCAHRPV
AIYHAAAYKHVPLVEQNAEEGVINNVLGTWTMARAAIKSKVNRFVLISTDKAVRPANIMG
GSKRIAEMILQSLAANSDYQMVADDQVEHDFHRTCFSMVRFGNVLGSSGSVVPLFRSQIA
EGGPLTVTHPEVTRFFMTIPEAAQLVLHAGAMAQEGDLFVLDMGKPVKIIELAKRMIALS
GHTVRDQENPNGDIPILITGLRAGEKLYEELLIGENPLPTAHPRIIKAREDFMPWPEFSI
LLEALLKAARSGDLSTMQHTMRLLIPAFSPQEALS