Protein Info for ABID97_RS02190 in Variovorax sp. OAS795

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01408: GFO_IDH_MocA
  • amino acids 5 to 128 (124 residues), 71.5 bits, E=1.1e-23
• PF02894: GFO_IDH_MocA_C
  • amino acids 155 to 300 (146 residues), 70.7 bits, E=1.6e-23

Best Hits

Swiss-Prot: 70% identical to WBPB_PSEAE: UDP-N-acetyl-2-amino-2-deoxy-D-glucuronate oxidase (wbpB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13016, UDP-D-GlcNAcA oxidase [EC: 1.1.1.-] (inferred from 76% identity to ajs:Ajs_3015)

MetaCyc: 70% identical to UDP-N-acetyl-2-amino-2-deoxyglucuronate dehydrogenase (Pseudomonas aeruginosa PAO1)
RXN-13585 [EC: 1.1.1.335]

Predicted SEED Role

"UDP-2-acetamido-2-deoxy-D-glucuronic acid dehydrogenase (NAD+ cofactor)"

MetaCyc Pathways

• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (4/5 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.335

Protein Sequence (317 amino acids)

>ABID97_RS02190 Gfo/Idh/MocA family oxidoreductase (Variovorax sp. OAS795)
MTNKNFALIGAAGYIAPRHMRAIKETGHTLAVAYDINDSVGIIDSLSPNAAFFTEFESFY
EHAHRLKRSEASALNYVSVCSPNHLHHAHCAAGLRLRCDVICEKPLVPSPDALDELARVE
SESGQRVFTILQLRHHEAILRLRNKVAAAPTDTRFDVDLSYITSRGKWYAASWKGDPRKS
FGVATNIGVHFFDMLHFVFGKLQGNVVHYSAEHKAAGFLEYERARVRWFLSIDAEDLPAE
VKGKKTTYRSITVDGEELEFSEGFTDLHTVSYGEILAGRGYGLQDARQAVEAVHAIRTAR
VNPSHSEQHPFTKRLSA