Protein Info for ABID97_RS02180 in Variovorax sp. OAS795

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 15 to 359 (345 residues), 408.4 bits, E=7.7e-126
• PF01212: Beta_elim_lyase
  • amino acids 24 to 216 (193 residues), 41.3 bits, E=3.2e-14
• PF01053: Cys_Met_Meta_PP
  • amino acids 32 to 157 (126 residues), 34.4 bits, E=2.4e-12
• PF00266: Aminotran_5
  • amino acids 36 to 191 (156 residues), 30.5 bits, E=5e-11
• PF00155: Aminotran_1_2
  • amino acids 36 to 210 (175 residues), 39.9 bits, E=8.1e-14

Best Hits

Swiss-Prot: 38% identical to MEDII_MICMH: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (megDII) from Micromonospora megalomicea subsp. nigra

KEGG orthology group: K13017, UDP-3-keto-D-GlcNAcA aminotransferase [EC: 2.6.1.-] (inferred from 70% identity to lch:Lcho_0293)

MetaCyc: 38% identical to dTDP-2,6-dideoxy-D-glycero-hex-2-enos-4-ulose transaminase (Micromonospora megalomicea)
RXN-12768 [EC: 2.6.1.106]; 2.6.1.- [EC: 2.6.1.106]

Predicted SEED Role

"Glutamate--UDP-2-acetamido-2-deoxy-D-ribohex-3-uluronic acid aminotransferase (PLP cofactor)"

MetaCyc Pathways

• dTDP-D-desosamine biosynthesis (3/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (4/8 steps found)
• dTDP-β-L-megosamine biosynthesis (4/8 steps found)
• superpathway of erythromycin biosynthesis (3/19 steps found)
• superpathway of megalomicin A biosynthesis (5/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (4/23 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.106

Protein Sequence (368 amino acids)

>ABID97_RS02180 DegT/DnrJ/EryC1/StrS family aminotransferase (Variovorax sp. OAS795)
MEFVDLKAQYRALKVQIDERIQRVLDHGQYIMGPEVAELEERLAAFTGARHCITVASGTE
ALLISLMAMGLKPGDEVITTPFTFAATAEMIVLLGGKPVFVDIEADTCNIDASLIEDKIT
DRTRAIMPVSLYGQCADMDEINAIAARHGLAVIEDAAQSFGATYKGRRSCNLSTFGCTSF
FPSKPLGCYGDGGAIFTSDDALAQACREIRVHGQSARYVHTRVGVGGRMDTLQCAIVLAK
LERFEWELAQRFAIGKRYDELLAGTLGVELLKVRDERSCVRSQYTVFIEGREAVQKALTK
QGVPCAVHYPRPVHLQTAYADHAAKADCPQSVLAGTRVLSLPMSADLTQPQQDRVVRALS
SALAARTG