Protein Info for ABID97_RS02180 in Variovorax sp. OAS795

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF01041: DegT_DnrJ_EryC1" amino acids 15 to 359 (345 residues), 408.4 bits, see alignment E=7.7e-126 PF01212: Beta_elim_lyase" amino acids 24 to 216 (193 residues), 41.3 bits, see alignment E=3.2e-14 PF01053: Cys_Met_Meta_PP" amino acids 32 to 157 (126 residues), 34.4 bits, see alignment E=2.4e-12 PF00155: Aminotran_1_2" amino acids 36 to 210 (175 residues), 39.9 bits, see alignment E=8.1e-14 PF00266: Aminotran_5" amino acids 36 to 191 (156 residues), 30.5 bits, see alignment E=5e-11

Best Hits

Swiss-Prot: 38% identical to MEDII_MICMH: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (megDII) from Micromonospora megalomicea subsp. nigra

KEGG orthology group: K13017, UDP-3-keto-D-GlcNAcA aminotransferase [EC: 2.6.1.-] (inferred from 70% identity to lch:Lcho_0293)

MetaCyc: 38% identical to dTDP-2,6-dideoxy-D-glycero-hex-2-enos-4-ulose transaminase (Micromonospora megalomicea)
RXN-12768 [EC: 2.6.1.106]; 2.6.1.- [EC: 2.6.1.106]

Predicted SEED Role

"Glutamate--UDP-2-acetamido-2-deoxy-D-ribohex-3-uluronic acid aminotransferase (PLP cofactor)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.- or 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>ABID97_RS02180 DegT/DnrJ/EryC1/StrS family aminotransferase (Variovorax sp. OAS795)
MEFVDLKAQYRALKVQIDERIQRVLDHGQYIMGPEVAELEERLAAFTGARHCITVASGTE
ALLISLMAMGLKPGDEVITTPFTFAATAEMIVLLGGKPVFVDIEADTCNIDASLIEDKIT
DRTRAIMPVSLYGQCADMDEINAIAARHGLAVIEDAAQSFGATYKGRRSCNLSTFGCTSF
FPSKPLGCYGDGGAIFTSDDALAQACREIRVHGQSARYVHTRVGVGGRMDTLQCAIVLAK
LERFEWELAQRFAIGKRYDELLAGTLGVELLKVRDERSCVRSQYTVFIEGREAVQKALTK
QGVPCAVHYPRPVHLQTAYADHAAKADCPQSVLAGTRVLSLPMSADLTQPQQDRVVRALS
SALAARTG