Protein Info for ABID97_RS01995 in Variovorax sp. OAS795

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 306 to 431 (126 residues), 68.2 bits, see alignment E=3.8e-23 PF00989: PAS" amino acids 307 to 423 (117 residues), 43.7 bits, see alignment E=7.4e-15 PF13188: PAS_8" amino acids 308 to 347 (40 residues), 23.2 bits, see alignment 1.5e-08 PF08448: PAS_4" amino acids 321 to 428 (108 residues), 29.8 bits, see alignment E=1.9e-10 PF13426: PAS_9" amino acids 323 to 425 (103 residues), 43.8 bits, see alignment E=8.2e-15 PF00512: HisKA" amino acids 450 to 517 (68 residues), 28.6 bits, see alignment E=3.7e-10 PF02518: HATPase_c" amino acids 562 to 681 (120 residues), 69.1 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: K11711, two-component system, LuxR family, sensor histidine kinase DctS [EC: 2.7.13.3] (inferred from 94% identity to vap:Vapar_5157)

Predicted SEED Role

"two-component hybrid sensor and regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (682 amino acids)

>ABID97_RS01995 PAS domain S-box protein (Variovorax sp. OAS795)
MEGALHVAPPRWALAAFVRLRSLWQRWFLWLILAVLVSALLVTVVWLAGRHEVEQVQATL
DRDTADAVSDLRIGLQRNAQSLRATQVSGVDRTHWPEAAASLLREHREWLRLEWRDAALR
PLEAVNTPYRMRLIDDESRGPDQSDVALACAAARKLGAPAYSPSHYVPILGGGGVEVMEL
CVPIDAGGFLVASYSLRDTLTELVGPTLTRGQEVAFTEADGTRLVALGTSRRTGTRVFTS
QQLIDLPGVALMLRVDGWRSAPDLFPNVLTALVTAISIALVSVLALLARDTRRRLRAERD
LADALAFRKAMEDSVITGLRARDLQGRITYVNPAFCEMVGFSPEELMAGSGEPIEAPYWP
TELAHEYQQRQARRLAGGMPPREGFESVFMRKDGTRFPVLIFEAPLINAQRVQTGWMSAF
IDISEQRRIEELSRASQERLQASARLATVGEMASLLSHELTQPLAAIASYATGSLNMLGP
HAKGEQAEVAMAVRRIAEQADRAGQVIRSVHDFVRRRDRTREAVAAQALIDAVLPLVRLQ
ARKLGVSIEVVLEEGLPKAMCDRTLVEQVLLNLARNGMQAMDMAESTTGRVLRLRVARVV
AVGGSGAEDARRWLEFSVADVGCGISDEVASRLFTPFFTTRADGMGLGLSLCRTVVEQHG
GVLMFEPNGARGTVFRFTLPVA