Protein Info for ABID97_RS01870 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 181 to 207 (27 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF05977: MFS_3" amino acids 23 to 539 (517 residues), 476.3 bits, see alignment E=1.1e-146 PF07690: MFS_1" amino acids 40 to 380 (341 residues), 116.4 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_5125)

Predicted SEED Role

"Probable major facilitator superfamily (MFS) transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>ABID97_RS01870 MFS transporter (Variovorax sp. OAS795)
MPPISPEETPIPPARPQPPKFAALVPLKLPVFRMLWSTWLIANICMWMNDVAAAWMMTSL
TTSPIWVALVQSASTLPVFLLGLPSGALADILDRRRWLVATQFWLAGTAIVLCAAIALEM
MTAPLLLALTFANGIGLALRWPVFSAIVPELVPRPQLPAALGLNGIAMNASRIIGPLTAG
MLIASAGSVWVFALNAVLSVASGFVVLRWRREHTPNPLGREKLISAMRVGVQFVWQSQRM
RAVLSRITIFFFHSTALLALLPLLARNLKGGGAGTFTLLLAAMGAGAIVAVLFLPRLRQA
LGRDQLVLRGTVLQSLATGVMAFAPNAWVAVPAMFFGGMAWITVANSLSVSAQLALPDWV
RARGMSTYQMAIMGASAIGAALWGQVATVSDLRSSLEIAALSGTLLMLAALRWVTDVSGE
EADMSPARAGWAAGPPAETPEENGRVVITIEYMIDPARAAAFHLVMHQTRRARLGQGAVG
WELLHDISEPARYVEQIVDESWTDHLRRFNRATAADMALRERRLAFHVGESPPVVTRYVV
RR