Protein Info for ABID97_RS01855 in Variovorax sp. OAS795

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 23 to 104 (82 residues), 91.6 bits, see alignment E=1.3e-30 PF02699: YajC" amino acids 26 to 101 (76 residues), 105.1 bits, see alignment E=7.3e-35

Best Hits

Swiss-Prot: 43% identical to YAJC_BRUSU: Sec translocon accessory complex subunit YajC (yajC) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 98% identity to vpe:Varpa_5841)

MetaCyc: 38% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>ABID97_RS01855 preprotein translocase subunit YajC (Variovorax sp. OAS795)
MFISSAFAQTAPAASGGGDMLSSLGSMLPLVLMFVVLYFVMIRPQMKRQKEARAMIEALA
KGDEVATAGGVLGKITSLGDQYLGLEIANGVEIKIQRSAVVQVLPKGAVKQ