Protein Info for ABID97_RS01845 in Variovorax sp. OAS795

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 290 (28 residues), see Phobius details PF07549: Sec_GG" amino acids 32 to 59 (28 residues), 32.1 bits, see alignment (E = 5.9e-12) TIGR00966: protein-export membrane protein SecF" amino acids 38 to 283 (246 residues), 248.4 bits, see alignment E=9.3e-78 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 97 to 279 (183 residues), 162.2 bits, see alignment E=1.5e-51 PF02355: SecD_SecF_C" amino acids 106 to 291 (186 residues), 214.8 bits, see alignment E=7.4e-68

Best Hits

Swiss-Prot: 41% identical to SECF_VIBAL: Protein translocase subunit SecF (secF) from Vibrio alginolyticus

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 95% identity to vap:Vapar_5118)

MetaCyc: 39% identical to Sec translocon accessory complex subunit SecF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABID97_RS01845 protein translocase subunit SecF (Variovorax sp. OAS795)
MEFFRIHKTIPFMRHALVLNIISFVTFALAVFFLLHRGLHLSVEFTGGTVMEVAYQQSAD
IGKVREAVGKLGYPDVQVQSYGTSRDVQIRLPAQKGMNSDQQSAQVMQALKAVDPSATQR
GIEVVGPQVGDELTTNGLKALGMVVVGIMIYLAFRFEWKFAVATVLANLHDVIIILGFFA
FFQWEFSLAVLAAVLAVLGYSVNESVVIFDRVRENFRRYRKMNTVEIIDNAITSTISRTI
ITHGSTQLVVLSMFFFGGPTLHYFALALTIGICFGIYSSAFVAAAIAMWLGVKREDLVKG
PVKRDGGPDDPNAGAVV