Protein Info for ABID97_RS01805 in Variovorax sp. OAS795

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 216 to 233 (18 residues), see Phobius details PF03591: AzlC" amino acids 24 to 168 (145 residues), 118.3 bits, see alignment E=1.8e-38

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_5110)

Predicted SEED Role

"Branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>ABID97_RS01805 AzlC family ABC transporter permease (Variovorax sp. OAS795)
MFLSAAIRRRPEFRMGMRDMSSAALGIGAWGLMTGVAMVKSNMSVLESVAMTLLVYAGSS
QLAAIPLLFAGAPAWVILATGFCVNLRFVVFSLHLRPYLMHMPRWRRMTHGYLTADLSYA
LFTRKYPSPPLAGDAQKAQEAYLTGNYFVTWCSWMGMSLLGIALANFIPQTWGLGFAGVL
SLVAIVCSMATTRLRVLAALIASVTAVAAYALPLKLNIVVAIGAAVLLCFWLEKQFGLDP
DAEDDK