Protein Info for ABID97_RS01745 in Variovorax sp. OAS795

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 64 to 88 (25 residues), see Phobius details PF13404: HTH_AsnC-type" amino acids 19 to 60 (42 residues), 61 bits, see alignment E=1.2e-20 PF13412: HTH_24" amino acids 19 to 66 (48 residues), 62.3 bits, see alignment E=3.8e-21 PF01037: AsnC_trans_reg" amino acids 83 to 165 (83 residues), 74.5 bits, see alignment E=7.4e-25

Best Hits

Swiss-Prot: 44% identical to LRP_KLEPN: Leucine-responsive regulatory protein (lrp) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_5098)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>ABID97_RS01745 Lrp/AsnC family transcriptional regulator (Variovorax sp. OAS795)
MSTTKLRAAPAQPAEAPALDRTDRAILRALQRDASVSNVALAAKVNLSAPACLRRVERLK
AAGLIRGIVALLDAKALELGMLVMIGVVLDRSTPDSFADFEKAAQKVSGCLECHVVTGEF
DYFMLVRTHDNDSFNRLHAEQLLYLPGVRQIRTFVVLKQVLSTTQLPI