Protein Info for ABID97_RS01735 in Variovorax sp. OAS795

Annotation: class II fructose-bisphosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00167: ketose-bisphosphate aldolase" amino acids 1 to 329 (329 residues), 329.2 bits, see alignment E=2.3e-102 TIGR01521: fructose-bisphosphate aldolase, class II, Calvin cycle subtype" amino acids 3 to 349 (347 residues), 579.7 bits, see alignment E=2.1e-178 PF01116: F_bP_aldolase" amino acids 4 to 328 (325 residues), 323.5 bits, see alignment E=6.7e-101

Best Hits

Swiss-Prot: 69% identical to ALF_XANFL: Fructose-bisphosphate aldolase (cbbA) from Xanthobacter flavus

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 96% identity to vpe:Varpa_5817)

MetaCyc: 64% identical to class II fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABID97_RS01735 class II fructose-bisphosphate aldolase (Variovorax sp. OAS795)
MALVSMRELLDHAAANGYGIPAFNVNNLEQVQAVMEAAKEVGAPVILQASAGARKYAGEA
FIKHLISAAIEAYPSVPLVMHQDHGQSPDVCRGAIDLGFSSVMMDGSLEADGKTIASYDY
NVEVTRKVADMAHKVGVTVEGELGCLGSLETMKGDKEDGHGTDDTMTREQLLTDPEQAAD
FVKRTQIDALAIAIGTSHGAYKFTREPTGDILAIDRIKEIHRRIPNTHLVMHGSSSVPQE
LLAIIRQYGGNMKETYGVPVKEIQEAIKHGVRKINIDTDIRLAMTGAVRKFLAENPEKFD
AREWLKPAREAARLICKQRYIEFGCEGQAPKIKGETLQVVAAKYAKGELAQEVR