Protein Info for ABID97_RS01730 in Variovorax sp. OAS795

Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase" amino acids 10 to 300 (291 residues), 249.7 bits, see alignment E=1.9e-78 PF01259: SAICAR_synt" amino acids 15 to 265 (251 residues), 261 bits, see alignment E=5.8e-82

Best Hits

Swiss-Prot: 81% identical to PUR7_POLNA: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 99% identity to vap:Vapar_5096)

MetaCyc: 45% identical to phosphoribosylamidoimidazole-succinocarboxamide synthetase (Saccharomyces cerevisiae)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABID97_RS01730 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Variovorax sp. OAS795)
MTTVHTSSIQSLPLLARGKVRDNYAVGNDRILMVASDRLSAFDVIMGEPIPGKGEILTQM
ALWWFDRLGQLCPNHLTGEAPESVVTPEEVPQVTGRSMLVKRLTPIPVEAVVRGYLAGSG
WKEYQESRSVCGVPLPEGLTNASKLPRPIFTPAAKAAAGEHDENISYDRVVEIVGPKLAQ
QIRETSLEIYETAAQIALAKGMIIADTKFEFGLDEAGTLVLMDEVLTPDSSRYWPVEGYQ
AALAAGTNPPSYDKQFVRDWLEATRINGKPWDKTPPAPRLPAEVIEKTAAKYREALERLT
G