Protein Info for ABID97_RS01700 in Variovorax sp. OAS795

Annotation: 5-(carboxyamino)imidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF22660: RS_preATP-grasp-like" amino acids 12 to 108 (97 residues), 116.4 bits, see alignment E=9.7e-38 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 13 to 374 (362 residues), 374.1 bits, see alignment E=4.3e-116 PF02222: ATP-grasp" amino acids 116 to 292 (177 residues), 169.8 bits, see alignment E=7.5e-54 PF17769: PurK_C" amino acids 313 to 376 (64 residues), 66.8 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 93% identity to vap:Vapar_5092)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABID97_RS01700 5-(carboxyamino)imidazole ribonucleotide synthase (Variovorax sp. OAS795)
MSSNGLPILPGATLGVLGGGQLGRMFAHAAQRMGYFTAVLDPDADSPAGRVSHHHIHTDY
ADVDGLARLAGLADAVTTEFENVPAPSLDKLSAARPVSPDAAAIAIAQDRIAEKAHFTRC
GVACAPYAVIETAAQLAAGEDGLLPGILKTARLGYDGKGQQRVTTRAELVDAWQAAHCVP
CVLEKMLPLEFECSVIVARGRDGQMVHFPPQRNLHRDGILAMTEVHAQNMPKTVAQAAIN
SARSIATGLNYVGVLCVEFFVLTDGSLVVNEMAPRPHNSGHYTMEACDVSQFELQVRTLA
GLPLAPPRQHSPAIMLNLLGDLWFTAGGTKPASPRWSEVLALPGAHLHLYGKIEPRRGRK
MGHLTLTGATLESVRATASEAAALLGLLPLSAADFA