Protein Info for ABID97_RS01665 in Variovorax sp. OAS795

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 4 to 215 (212 residues), 189.5 bits, E=3.8e-60
• PF00814: TsaD
  • amino acids 38 to 131 (94 residues), 88.7 bits, E=2.8e-29

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 92% identity to vap:Vapar_5085)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (242 amino acids)

>ABID97_RS01665 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB (Variovorax sp. OAS795)
MPRLLAFDTSTEHLSVAVRHGERVFTHSGAGGAQASGTLIPLILQLLAEAGLPLAALDAI
AFGRGPGSFTGLRTACSVAQGLAFGAGVPLLPVDTLLAVAEEARHAFGARQVVAALDARM
DQLYAARYDFDAGGALGALPGDAGEPLLIAPEALDVPAGWSLAGNAFAAYGPRLAPAAAR
LEVLPTATAMLRLAPALLAAGRTVDAAHAWPLYVRDKVAQTTDERAAIKAAAAAAISPAS
SP