Protein Info for ABID97_RS01640 in Variovorax sp. OAS795

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 56 to 73 (18 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_5080)

Predicted SEED Role

"FIG00933173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABID97_RS01640 hypothetical protein (Variovorax sp. OAS795)
MHPPPLSRRERGLLFTFALLALVALFGPELPAADVAIASVFADGRAWNGLPNAMDVLSNL
PFALVGGWGLYRLHRIDRAHQQALAEFPLAPPASDPPDNTLDCAWLFFAGLIATAAGSAF
FHLMPDASRLAADRAGMAVAFAGLIGVAVCERVSQRAGWPAAWFVLAAGLLAAEVFHESG
NVLPWAVVQFGGMALVLTLALATPMRGAVGLRLGWVIFFYALAKGFELADEAIYEVTGQL
ISGHSLKHLAASLAGLPVLAALRKLDIGWRATLLRHNPDAALTT