Protein Info for ABID97_RS01635 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 68 to 89 (22 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 442 to 458 (17 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details PF07690: MFS_1" amino acids 37 to 350 (314 residues), 48.3 bits, see alignment E=1.1e-16 PF05977: MFS_3" amino acids 78 to 342 (265 residues), 31 bits, see alignment E=1.4e-11 PF01553: Acyltransferase" amino acids 457 to 590 (134 residues), 103.2 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_5079)

Predicted SEED Role

"Lysophospholipid transporter LplT / 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) / Acyl-[acyl-carrier-protein] synthetase (EC 6.2.1.20)" (EC 2.3.1.40, EC 6.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.40 or 6.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>ABID97_RS01635 MFS transporter (Variovorax sp. OAS795)
MTNPAAATAATPPHEANAHANQFALLGQRRFAPFFWTQFAGAANDNLFKFAFTVMVTYQL
QLSWMPPAMAGLAIGALFILPFLLFSATAGQLTDKFDKTKIIRFVKNLEIAIMLLAAWGF
VRADAPVLLGCVFLMGLHSTLFGPVKFAYLPQVLDARELTGGNGMVEMGTFVAILLGQVA
GGLLVALPQVGHTTVAVACVLLALVGRGVAQAIPAAPATDPGLVINWNPFSETWRNLKLA
HGNIVVFRSLLGISWMWFFGAVFLSQFPSFAKEVLHGDEQVASLLLVVFSVGIGVGSLLC
ETLSRRQVEIGLVPLGAIGMSVFAIDLYFASRALPPVAVMGLGTFVGQAAHWRVMADLAL
LSLFAGLYSVPMYALIQLRSQPTHRARIIAANNILNALFMIGSSVIAGALLGAGFTIPQI
FLFTGIANAVVAFYIFMLVPEYLLRFIAWMLSHFVYRFEIKGDEHIPTEGAAVLVCNHVS
FIDAILLMAASPRPIRFIMDHRIFKVPVLGWLFKLAKAIPIAPQKEDPAAYEAAFARALQ
VLREGDLLAIFPEGAITRDGKLQPFKGGVMKIIESARAEGIEPPVIPMALTNLWGSYFSR
IELRGGENVAMAKPFRRGFFSRVGLRVGNPVPPSDVRPEALQQRVSGLLGA