Protein Info for ABID97_RS01580 in Variovorax sp. OAS795

Annotation: TIGR01777 family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 68 to 88 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details PF01370: Epimerase" amino acids 191 to 403 (213 residues), 78.1 bits, see alignment E=7.3e-26 TIGR01777: TIGR01777 family protein" amino acids 191 to 491 (301 residues), 280.2 bits, see alignment E=1.2e-87 PF08338: DUF1731" amino acids 449 to 494 (46 residues), 59.1 bits, see alignment 2.9e-20

Best Hits

KEGG orthology group: K07071, (no description) (inferred from 87% identity to vpe:Varpa_5787)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>ABID97_RS01580 TIGR01777 family oxidoreductase (Variovorax sp. OAS795)
MIDTHLLALQLMAAQGLLGAFDTLYHHEGTEALAQRDTAGRELSIHAVRSSLYCALFIGL
SSWAWHGAWAWVLLAVFGVEIVLTLWDFVVEDRSRLLPPTERVTHTVLAINAGAFIALLA
LAAVDWAVQPTALAWQPQGWLGAFLALCGVGVGLSGLRDALAARALLRRAANEEARATEA
PVRFGTRPQRVLVTGGTGFIGQTLVRHLLADGHAVTVWSRDARSAAWGFGGAVRCVQRLD
QIPEADPCDVVINLAGARILGRRWSARRQRALRQSREGLTAALVAWMAARPRKPWLLLSA
SAIGYYGVQPQGDATELAEDAPPQDIFMSSLCEEWERAANVAALHGVNVACMRFGFVLGH
QGSLPQLLLPVSLGMGGRLGSGRQWLSWVHVHDVIRAIAHVWGLAEEAPAGQPATTQAYN
FTAPGALSQEEFTRVAASVLRRPCWMPTPAGPVRLLLGEQADLLLEGQRVVPARLLQTGF
RFAFADARAALTDLCRPR