Protein Info for ABID97_RS01565 in Variovorax sp. OAS795

Annotation: DNA starvation/stationary phase protection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00210: Ferritin
  • amino acids 50 to 190 (141 residues), 104.3 bits, E=2.7e-34

Best Hits

Swiss-Prot: 54% identical to Y1894_SYNY3: Uncharacterized protein slr1894 (slr1894) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 93% identity to vap:Vapar_5065)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Protein Sequence (190 amino acids)

>ABID97_RS01565 DNA starvation/stationary phase protection protein (Variovorax sp. OAS795)
MAKASKKTSSSSQGKLPKKGEALVAQESGSRNAPIINIGIERQDRAAIAEGLSRVLADTY
TLYLTTHNFHWNVTGPHFNSLHAMFMGQYTELWGATDVIAERIRALGHYAPGSYAEFSKI
ATVPDVPQAPPKAMEMVRILVKGHETVSRIAREFIPVAEEAGDDPTADMLTARCTVHDQT
AWMLRSLLED