Protein Info for ABID97_RS01555 in Variovorax sp. OAS795

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 19 to 278 (260 residues), 254.8 bits, E=5.3e-80
• PF03807: F420_oxidored
  • amino acids 19 to 102 (84 residues), 57 bits, E=2.5e-19
• PF14748: P5CR_dimer
  • amino acids 174 to 278 (105 residues), 122 bits, E=1.3e-39

Best Hits

Swiss-Prot: 36% identical to P5CR_SYNY3: Pyrroline-5-carboxylate reductase (proC) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 90% identity to vap:Vapar_5062)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (2/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Protein Sequence (285 amino acids)

>ABID97_RS01555 pyrroline-5-carboxylate reductase (Variovorax sp. OAS795)
MTIAVTFLPRTGPAPLPPIAFIGGGNMASAIIGGLLKQGTPADAFEVVEPFEEARQKLAQ
SFGITAQAEAGEALSRCAVVVWAVKPQTFADAAKPVRAFAGSALHLSVAAGIPSTSIARW
LGSERVVRAMPNTPALVGQGMTGLYARAGVDAADRALVGQLLAPTGELLWVDDEAALDAV
TAMSGSGPAYVFYFIEAMTEAGVEMGLSPEQAQRLAIGTFTGASALAHSATEPPSVLRER
VTSKGGTTYAALTSLEGADVKAKFKTAIRAAQKRAAELGEEFGKD