Protein Info for ABID97_RS01420 in Variovorax sp. OAS795

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF02353: CMAS" amino acids 109 to 392 (284 residues), 312.6 bits, see alignment E=7.9e-97 PF13489: Methyltransf_23" amino acids 155 to 274 (120 residues), 43.3 bits, see alignment E=1.1e-14 PF13847: Methyltransf_31" amino acids 169 to 272 (104 residues), 30.7 bits, see alignment E=8.6e-11 PF13649: Methyltransf_25" amino acids 174 to 269 (96 residues), 54.8 bits, see alignment E=4.4e-18 PF08242: Methyltransf_12" amino acids 174 to 270 (97 residues), 41.1 bits, see alignment E=8.9e-14 PF08241: Methyltransf_11" amino acids 174 to 271 (98 residues), 41.5 bits, see alignment E=5.9e-14

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 94% identity to vap:Vapar_5037)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>ABID97_RS01420 cyclopropane-fatty-acyl-phospholipid synthase family protein (Variovorax sp. OAS795)
MQSLIPKIESQLASLPVPIALELPDGRRVAKPGSRVTLAFSDWSALAKLAARQVGAIGEA
YVEGKVQIEGAMRDLIDATVGMLPGNPAETDTAWWTRLMRLAKSRGAHSLNKDAEQIQFH
YDVSDDFYALWLDPRRVYSCAYFRTPELSLAEAQEAKLDHICRKLMLQPGERFLDIGSGW
GGLLLWAAEHYGVDATGITLSKNQHTHVQQLIEEKGLQGRVRVELRDYRELSADAPFDKI
SSVGMFEHVGSAFMPTYFRKIHSLLKPGGLVLNHGITSGQLDYRQLGAGMGDFIEKYIFP
GGELLHVTHVLRETAAAGLEMVDTESLRPHYARTLWAWSDALEAQLGTARKVLERAGGRQ
GENAERILRAYRLYLAGSAMSFEQGWISLHQMLSTRPDGRVEHGVLRGSQSVYPFARDYI
YK