Protein Info for ABID97_RS01265 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 74 to 97 (24 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 163 (29 residues), see Phobius details amino acids 175 to 203 (29 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 38 to 254 (217 residues), 84.4 bits, see alignment E=8.1e-28 amino acids 240 to 447 (208 residues), 53.9 bits, see alignment E=1.5e-18 PF07690: MFS_1" amino acids 57 to 284 (228 residues), 64.1 bits, see alignment E=1.2e-21 amino acids 271 to 441 (171 residues), 59.1 bits, see alignment E=3.7e-20

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 70% identity to bgd:bgla_1g12560)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ABID97_RS01265 MFS transporter (Variovorax sp. OAS795)
MNTSQTMGLPEGPGARPAHAFSNDAVDPLARATARKAALAASVGTAIEYYEFGVYGYMAA
TIGPLFFPSTDATASLLAILAVFGSAFLMRPIGGIVLGRLGDRIGRRGILLVTVIGMGIA
TAAIGLLPVASTAGIAAPILLLAIRLVQGFFAGGEVTGAAAYVAESAPRGKRGFYGAFTP
VGVAVGGALAAAACGLTSALLSAEQMQQWGWRIPFLLAIPMVIVSTAVRRRVEESAAFQE
FQAHNEPTKAPLREVLTQHASKVLKVTALAFGQNVGYWVGLVFMNIYLTTYLKYDKTTVY
WIMAAVGVTMAILMPFWGGLSDRWGRRRVLGIGFLGYMVLVWPMMILMDQQSIGLAALAM
FIIALPLPIVQSVGYPTYAEQFPTRIRYTGMAFSFNIGAILGGGVTPYVATSLIASTGNL
KSPAILLIAAAIFSLLALLTVRETSKDRLA