Protein Info for ABID97_RS01255 in Variovorax sp. OAS795

Annotation: 5-oxoprolinase subunit PxpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03746: LamB_YcsF
  • amino acids 4 to 242 (239 residues), 338 bits, E=1.7e-105

Best Hits

Swiss-Prot: 61% identical to PXPA_BORPE: 5-oxoprolinase subunit A (pxpA) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K07160, UPF0271 protein (inferred from 82% identity to vei:Veis_0374)

MetaCyc: 49% identical to 5-oxoprolinase component A (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Lactam utilization protein LamB"

MetaCyc Pathways

• 5-oxo-L-proline metabolism (5/6 steps found)
• γ-glutamyl cycle (4/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.9

Use Curated BLAST to search for 3.5.2.9

Protein Sequence (270 amino acids)

>ABID97_RS01255 5-oxoprolinase subunit PxpA (Variovorax sp. OAS795)
MASIDFNSDVGESYGVYRLGDDAAVLDHVTSANVACGMHAGDPQTIAATVALAVARGVSI
GAHPGFADLQGFGRRPMQLGRDELHHLVVYQIGALQAFCTAAGTRLAHVKTHGALYNMAA
RDPAMARAVADAVRAVDPQLVFYGLAGSELVRSAREAGLAVAEEVFADRSYQDDGALTPR
SHPGALITDIRQSVAQVLRMVRSGVVRSVHGVDVPVRPDTLCIHGDQPDAANFARAIRQA
LEAEGVSVRPASRRAIALGPASPLTPGAHA