Protein Info for ABID97_RS01220 in Variovorax sp. OAS795

Annotation: M20 aminoacylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR01891: amidohydrolase" amino acids 16 to 377 (362 residues), 343.7 bits, see alignment E=7e-107 PF01546: Peptidase_M20" amino acids 74 to 386 (313 residues), 150.3 bits, see alignment E=7e-48 PF07687: M20_dimer" amino acids 187 to 281 (95 residues), 45.8 bits, see alignment E=5.4e-16

Best Hits

Swiss-Prot: 43% identical to ILL3_ORYSJ: IAA-amino acid hydrolase ILR1-like 3 (ILL3) from Oryza sativa subsp. japonica

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 83% identity to pol:Bpro_4523)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ABID97_RS01220 M20 aminoacylase family protein (Variovorax sp. OAS795)
MHTLLEQLHAQAGEFIGLRRDIHRHPELAFDEHRTSELVAGKLRQWGYEVEQGIGGTGVV
GRLVRGNGTRRLGLRADMDALPIDEATGLPYASRHAGVMHACGHDGHTAMLLAAAHHLAT
RGHFDGTLNLVFQPAEEGGGGALRMMEDGLFDRYPCDAIFAMHNLPGLAQGRLALRDGPA
MASSDYATVTLTGIGGHGAMPHRAADPIVAAASIVMALQTIVSRNIDPLQMAVVTVGAIH
AGKANNVIPQDAVLEISVRALDRGVRSTLEARIRSLVAAQAESFGVAARTDWRPGYAVLV
NTPGETALAREVALELVGADRVVLQGPAVPASEDFAFMLERVPGSYVQIGNGEGDGHGAC
MVHNPGYDFNDDNVAVGSAFWVLLAERFLRSVE