Protein Info for ABID97_RS01190 in Variovorax sp. OAS795

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF08659: KR" amino acids 10 to 164 (155 residues), 52.5 bits, see alignment E=9.2e-18 PF00106: adh_short" amino acids 10 to 202 (193 residues), 192.9 bits, see alignment E=6.3e-61 PF13561: adh_short_C2" amino acids 17 to 250 (234 residues), 198.3 bits, see alignment E=2.3e-62

Best Hits

Swiss-Prot: 62% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 91% identity to vpe:Varpa_2279)

MetaCyc: 62% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>ABID97_RS01190 SDR family oxidoreductase (Variovorax sp. OAS795)
MKLFDLSGRTALITGSSKGIGFALASALGSAGARIVLNARDAGALEAARDALRARGVAAE
AVAFDVTDAQAVEAGVARIEAEVGAIDILVNNAGMQHRGAFAEFPIDAWHKITTTNIDSV
FFVGRFVAQRMIERKRGKIINVCSVQSELGRPGIAPYAATKGAVKMLTKGMAIDLGKHGI
QVNGLGPGYFKTELTETLVADEAFTAWLSGRTPAGRWGDVEELGGAAIFLASDASSFVNG
HILYVDGGITASL