Protein Info for ABID97_RS01170 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 353 (30 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 382 (337 residues), 106.5 bits, see alignment E=7.1e-35

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 96% identity to vap:Vapar_5023)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABID97_RS01170 ABC transporter permease (Variovorax sp. OAS795)
MSNPTPGWWRRTGVDLRLLLMSVLLVAMGIVFNVMSGGVFLSPENLYNVAQQTAVVGIVA
TVMVLVIVARHIDLSVGSVMGFVGVLIAYLQYTSGWSWPTACLAGLAVALLVSIYQGWLT
AMLGVPSFVVTLGGLMSFRGAAFLVADGKTQPVNDEFFQRLGGGYDGGIGTTATWVLAAF
VAVVLFARMLQKRRARAHHEMPNEPLWLELLLTAVPVAVVLVFAAVMNSYRIPSKDAPQG
LPIPVLIWAVVAIVLSFIVHRTRFGRYVFAMGGNPDAAALVGIPVKRVTLMLFALLAVLV
TVAAIVSIARLNAGTNSLGNGMELYVIAAAVIGGTALAGGSGSIFGSVLGALIMQSLDSG
MLLLDVPIGKRMVIIGQVLIVAVVFDVLYRRKFGEN