Protein Info for ABID97_RS01025 in Variovorax sp. OAS795

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 132 to 157 (26 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 381 to 389 (9 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details amino acids 498 to 520 (23 residues), see Phobius details amino acids 540 to 563 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 7 to 571 (565 residues), 773.8 bits, see alignment E=5.1e-237 PF03814: KdpA" amino acids 11 to 570 (560 residues), 800.9 bits, see alignment E=2.4e-245

Best Hits

Swiss-Prot: 88% identical to KDPA_VARPS: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 88% identity to vap:Vapar_4995)

MetaCyc: 64% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>ABID97_RS01025 potassium-transporting ATPase subunit KdpA (Variovorax sp. OAS795)
MTASAGSLLAVFLVALVLLAWPAGKLLAALCDERLPRWMQRIEAPLYRLAGTEPGTSMHW
RAYALALLAFNTLGAVFLYALQRLQGALPLNPAAMGAVSPDSAFNSAVSFVSNTDWQGYG
GESTMSYLTQMLGFTVQNFFSAATGIAVAFVLIRGFARRGDGKGRGLVGNFWADLTRITL
WLLVPLSFVLALLFVGQGVIQNFDPYEAVHTVEASASGQTIAMGPVASQEAIKMIGTNGG
GFFNANSAHPFENPTAFSNLLQMIAIFLIPAALCLAFGRVVGDRRQGWAVLAAMAAMFVA
AVMVLMPAEQAGNPLLASLGVDQVASALQGGGNMEGKEVRFGIDASALFAAITTAASCGA
VNAMHDSFTPLGGMVPMVLMQLGEVVFGGVGSGLYGMLIFAMLAVFIAGLMIGRTPEYLG
KKIEVREMKLISIAILVTPVLVLAGTAVALMAGAGKAGIANPGAHGFSEVLYALSSAANN
NGSAFAGLSANTPFYNGLLGLAMWLGRFAVIVPVLAIAGSLAAKQRLPVTGGTLPTHGPL
FVSLLIGTVLLVGLLNYVPALALGPVVEHLVLWK