Protein Info for ABID97_RS00965 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 187 to 231 (45 residues), 30.8 bits, see alignment 3.5e-11 PF00512: HisKA" amino acids 237 to 300 (64 residues), 50.3 bits, see alignment E=3.1e-17 PF02518: HATPase_c" amino acids 349 to 443 (95 residues), 78.7 bits, see alignment E=7.1e-26

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_4982)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>ABID97_RS00965 ATP-binding protein (Variovorax sp. OAS795)
MTASRGSRIWRPRSLRTQLLFWLVTLHLAAAALTAWFTFVAYGDLVHNALDEQMRLVADS
YAGSDPPRTPRPLDSEAVARGAFVVQLWSADGATLRANSWPPLAAVPLHPALGFSDAATG
APMPSRWRVFTAEPGPRADQPRVQVLQNEDYRRRRALRRALLEGLPIALLLPLALLILWL
IVSAASRSLRAVARDVASQDERSPTDLSLARVPEEIAPLVHAFNHLLSRVRNAFATQRRF
VQDAAHELRTPMAAIGLQIENLRAHVPAGEATERFNQLEAGVTRAQHLIEQLLSLSRQDA
PGRAMSREPVDIETLLRESVSQLMVLADARRVDIGFEGRIAPVLLAPPAELRSVFDNLID
NALRYAPEGGVVDVRLHEAEGHAVVDVLDNGPGIPASSIGRVFDRFFRVPGAPAGGSGLG
LAIARTAAERHGMRIELRNRDDGPGLMARVHLIAPAVPLTSS